Do you want GlyGen to remember your searches for your future use? This can be changed at any time in the My GlyGen section.
  • General
  • 3D View
  • Glycosylation
  • Phosphorylation
  • Glycation
  • Names
  • Function
  • Sequence
  • Single Nucleotide Variation
  • Mutagenesis
  • GO Annotation
  • Glycan Ligands
  • PTM Annotation
  • Proteoform Annotation
  • Pathway
  • Synthesized Glycans
  • Isoforms
  • Homologs
  • Disease
  • Biomarkers
  • Expression Tissue
  • Expression Disease
  • Cross References
  • History
  • Publications
Look At

Details for Glycoprotein Q9HAU4-1

General

Gene Name: SMURF2
Gene Location: Chromosome: 17 (64,542,282 - 64,662,307)
UniProtKB ID: SMUF2_HUMAN
UniProtKB Accession: Q9HAU4-1
Protein Length: 748
UniProtKB Entry Name: E3 ubiquitin-protein ligase SMURF2
Chemical Mass: 86,196 Da
RefSeq Accession: NP_073576
RefSeq Name: E3 ubiquitin-protein ligase SMURF2
Organism: Human
Reference Species: Homo sapiens [9606]

3D View

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

1 3D structure provided by PDB (View on PDB: 2jqz)
2 Displayed using Mol*

Glycosylation

Glycosylation Summary: 2 site(s) total, 1 N-linked site(s), 1 O-linked site(s)
Summary: 2 site(s) total, 1 N-linked glycan(s) at 1 site(s), 1 O-linked glycan(s) at 1 site(s)
Records per page Showing 1 to 2 of 2 Results
SourceTypeGlyTouCan AccessionGlycan ImageResidueNote
O-linkedG57321FI
Glycan img
Thr76Data provided by GlycoDomainViewer
N-linkedG62765YT
Glycan img
Asn125
Showing 1 to 2 of 2 Results

Phosphorylation

Records per page Showing 1 to 13 of 13 Results
SourceKinase ProteinKinase GeneResidueNote
No data availableNo data availableSer44
No data availableNo data availableThr144
No data availableNo data availableThr168
No data availableNo data availableSer170
No data availableNo data availableSer203
No data availableNo data availableThr249
No data availableNo data availableTyr314
No data availableNo data availableSer384
No data availableNo data availableSer406
No data availableNo data availableTyr407
No data availableNo data availableTyr434
No data availableNo data availableTyr465
No data availableNo data availableTyr499
Showing 1 to 13 of 13 Results

Glycation

No data available.

Function

(Microbial infection) In case of filoviruses Ebola/EBOV and Marburg/MARV infection, the complex formed by viral matrix protein VP40 and SMURF2 facilitates virus budding.

AIMP2 restricts EV71 replication by recruiting SMURF2 to promote the degradation of 3D polymerase.

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates (PubMed:11016919). Interacts with SMAD7 to trigger SMAD7-mediated transforming growth factor beta/TGF-beta receptor ubiquitin-dependent degradation, thereby down-regulating TGF-beta signaling (PubMed:11163210, PubMed:12717440, PubMed:21791611). In addition, interaction with SMAD7 activates autocatalytic degradation, which is prevented by interaction with AIMP1 (PubMed:18448069). Also forms a stable complex with TGF-beta receptor-mediated phosphorylated SMAD1, SMAD2 and SMAD3, and targets SMAD1 and SMAD2 for ubiquitination and proteasome-mediated degradation (PubMed:11016919, PubMed:11158580, PubMed:11389444). SMAD2 may recruit substrates, such as SNON, for ubiquitin-dependent degradation (PubMed:11389444). Negatively regulates TGFB1-induced epithelial-mesenchymal transition and myofibroblast differentiation (PubMed:30696809).

FOXO1 regulates RUNX2 ubiquitination through SMURF2 in calcific aortic valve disease.

Flavin containing monooxygenase 2 regulates renal tubular cell fibrosis and paracrine secretion via SMURF2 in AKI-CKD transformation.

Loss of SMURF2 expression enhances RACK1 stability and promotes ovarian cancer progression.

Smurf2-Mediated Ubiquitination of FOXO4 Regulates Oxygen-glucose Deprivation/Reperfusion-induced Pyroptosis of Cortical Neurons.

Sequence

1MSNPGGRRNG PVKLRLTVLC AKNLVKKDFF RLPDPFAKVV VDGSGQCHST DTVKNTLDPK
61WNQHYDLYIG KSDSVTISVW NHKKIHKKQG AGFLGCVRLL SNAINRLKDT GYQRLDLCKL
121GPNDNDTVRG QIVVSLQSRD RIGTGGQVVD CSRLFDNDLP DGWEERRTAS GRIQYLNHIT
181RTTQWERPTR PASEYSSPGR PLSCFVDENT PISGTNGATC GQSSDPRLAE RRVRSQRHRN
241YMSRTHLHTP PDLPEGYEQR TTQQGQVYFL HTQTGVSTWH DPRVPRDLSN INCEELGPLP
301PGWEIRNTAT GRVYFVDHNN RTTQFTDPRL SANLHLVLNR QNQLKDQQQQ QVVSLCPDDT
361ECLTVPRYKR DLVQKLKILR QELSQQQPQA GHCRIEVSRE EIFEESYRQV MKMRPKDLWK
421RLMIKFRGEE GLDYGGVARE WLYLLSHEML NPYYGLFQYS RDDIYTLQIN PDSAVNPEHL
481SYFHFVGRIM GMAVFHGHYI DGGFTLPFYK QLLGKSITLD DMELVDPDLH NSLVWILEND
541ITGVLDHTFC VEHNAYGEII QHELKPNGKS IPVNEENKKE YVRLYVNWRF LRGIEAQFLA
601LQKGFNEVIP QHLLKTFDEK ELELIICGLG KIDVNDWKVN TRLKHCTPDS NIVKWFWKAV
661EFFDEERRAR LLQFVTGSSR VPLQGFKALQ GAAGPRLFTI HQIDACTNNL PKAHTCFNRI
721DIPPYESYEK LYEKLLTAIE ETCGFAVE

Single Nucleotide Variation

Records per page Showing 1 to 7 of 7 Results
SourceFilter AnnotationsGenomic LocusStart Pos.End Pos.SequenceDiseaseMAF
Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->M).Chr17:645935477676T → M
Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NDT->NDI).Chr17:64591104127127T → I
Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NGA->NGT).Chr17:64580909218218A → T
Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NYM->NYT).Chr17:64580836242242M → T
Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DLS->NLS).Chr17:64571955287287D → N
Somatic mutation passed 1 out of 6 filters: num. of cancers (3).Chr17:64562802394394R → H
Somatic mutation passed 1 out of 6 filters: patient count (13/2053).Chr17:64561537427427R → C
Showing 1 to 7 of 7 Results

Mutagenesis

Records per page Showing 1 to 13 of 13 Results
SourceStart Pos.End Pos.SequenceNote
251284PDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRV (deletion)Abolishes interaction with SMAD2 and SMAD7.
297330GPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRL (deletion)Abolishes interaction with SMAD7.
2930FF → AAIncreases auto-ubiquitination.
535535W → ALoss of catalytic activity.
535535W → DLoss of catalytic activity.
547547H → APartial loss of catalytic activity.
547547H → FActivates autocatalytic activity.
547547H → IActivates autocatalytic activity.
5656T → AIncreases auto-ubiquitination; when associated with A-57.
5757L → AIncreases auto-ubiquitination; when associated with A-56.
581581Y → ALoss of catalytic activity.
716716C → ALoss of catalytic activity. Increases SMAD7-bound TGF-beta receptors in membrane rafts. Decreases interaction with TTC3. Decreased VP40 virus-like particle budding.
716716C → GLoss of activity. Loss of ability to ubiquitinate SMAD1 and SMAD2 and no down-regulation of SMAD1 and SMAD2 protein levels.
Showing 1 to 13 of 13 Results

GO Annotation

Cellular Component
cytoplasm (GO:0005737)
cytosol (GO:0005829)
membrane raft (GO:0045121)
nuclear speck (GO:0016607)
nucleoplasm (GO:0005654)

Total 8 in Cellular Component category.

Molecular Function
identical protein binding (GO:0042802)
SMAD binding (GO:0046332)
ubiquitin protein ligase activity (GO:0061630)
ubiquitin-protein transferase activity (GO:0004842)

Total 4 in Molecular Function category.

Glycan Ligands

No data available.

PTM Annotation

Records per page Showing 1 to 1 of 1 Results
SourceAnnotation
Auto-ubiquitinated and ubiquitinated in the presence of RNF11 and UBE2D1 (PubMed:19343052, PubMed:30696809). Ubiquitinated by the SCF(FBXL15) complex and TTC3, leading to its degradation by the proteasome (PubMed:21572392, PubMed:30696809). 'Lys-48'-linked polyubiquitination mediated by TRAF4 at Lys-119 leads to SMURF2 proteasomal degradation (PubMed:31076633).
Showing 1 to 1 of 1 Results

Proteoform Annotation

No data available.

Pathway

Synthesized Glycans

No data available.

Isoforms

UniProtKB Isoform Accession: J3QLG1-1
Isoform length: 55
Chromosome: 17 (64661880 - 64594101)
UniProtKB Isoform Accession: J3QQM4-1
Isoform length: 561
Chromosome: 17 (64661880 - 64554882)
UniProtKB Isoform Accession: J3QRY2-1
Isoform length: 68
Chromosome: 17 (64661880 - 64594101)
UniProtKB Isoform Accession: Q9HAU4-1
Isoform length: 748
Chromosome: 17 (64661880 - 64545851)

Homologs

UniProtKB Homolog Accession: A0A0G2K612-1
Protein Name: E3 ubiquitin-protein ligase
Gene Name: Smurf1
Organism: Rat
Reference Species: Rattus norvegicus [10116]
UniProtKB Homolog Accession: A0A287ATZ7-1
Protein Name: E3 ubiquitin-protein ligase
Gene Name: SMURF2
Organism: Pig
Reference Species: Sus scrofa [9823]
UniProtKB Homolog Accession: A0A8V1AC55-1
Protein Name: E3 ubiquitin-protein ligase
Gene Name: SMURF2
Organism: Chicken
Reference Species: Gallus gallus [9031]
UniProtKB Homolog Accession: A2A5Z6-1
Protein Name: E3 ubiquitin-protein ligase SMURF2
Gene Name: Smurf2
Organism: Mouse
Reference Species: Mus musculus [10090]
UniProtKB Homolog Accession: A9JRZ0-1
Protein Name: E3 ubiquitin-protein ligase SMURF2
Gene Name: smurf2
Organism: Zebrafish
Reference Species: Danio rerio [7955]
UniProtKB Homolog Accession: F1M3F2-1
Protein Name: E3 ubiquitin-protein ligase
Gene Name: Smurf2
Organism: Rat
Reference Species: Rattus norvegicus [10116]
UniProtKB Homolog Accession: Q6PCR3-1
Protein Name: E3 ubiquitin-protein ligase
Gene Name: smurf1
Organism: Zebrafish
Reference Species: Danio rerio [7955]
UniProtKB Homolog Accession: Q9CUN6-1
Protein Name: E3 ubiquitin-protein ligase SMURF1
Gene Name: Smurf1
Organism: Mouse
Reference Species: Mus musculus [10090]
UniProtKB Homolog Accession: Q9HCE7-1
Protein Name: E3 ubiquitin-protein ligase SMURF1
Gene Name: SMURF1
Organism: Human
Reference Species: Homo sapiens [9606]
UniProtKB Homolog Accession: Q9V853-1
Protein Name: E3 ubiquitin-protein ligase Smurf1
Gene Name: Smurf
Organism: Fruit fly
Reference Species: Drosophila melanogaster [7227]

Disease

Records per page Showing 1 to 1 of 1 Results
SourceDiseaseDescription
diffuse large B-cell lymphoma (DOID:0050745) A large B-cell lymphoma that is consisting of medium-sized to large B cells with a diffuse growth pattern.
Showing 1 to 1 of 1 Results

Biomarkers

No data available.

Expression Tissue

Records per page Showing 1 to 13 of 13 Results
SourceTissueExpression RelativeExpression Score
Adult mammalian kidney (UBERON: 0000082)MEDIUM76.44
Oral cavity (UBERON: 0000167)HIGH86.7
Stomach (UBERON: 0000945)MEDIUM79.61
Uterus (UBERON: 0000995)LOW58.25
Esophagus (UBERON: 0001043)HIGH87.27
Rectum (UBERON: 0001052)HIGH85.81
Colon (UBERON: 0001155)LOW54.95
Urinary bladder (UBERON: 0001255)HIGH83.77
Thyroid gland (UBERON: 0002046)HIGH86.62
Lung (UBERON: 0002048)HIGH81.14
Liver (UBERON: 0002107)MEDIUM79.75
Prostate gland (UBERON: 0002367)HIGH83.85
Thoracic mammary gland (UBERON: 0005200)HIGH85.37
Showing 1 to 13 of 13 Results

Expression Disease

Records per page Showing 1 to 12 of 12 Results
SourceDiseaseExpression TrendSignificant
upYes
upNo
upNo
upYes
downYes
downYes
upYes
upNo
upYes
downYes
upNo
upYes
Showing 1 to 12 of 12 Results

History

  • Introduced in data release 1.0.13

Publications

Sort By
Records per page Showing 1 to 200 of 292 Results
AIMP2 restricts EV71 replication by recruiting SMURF2 to promote the degradation of 3D polymerase.
Ren Junrui, Yu Lei, Zhang Qiuhan, Ren Pengyu, Cai Yumeng, Wang Xueyun, Lan Ke, Wu Shuwen
Virologica Sinica  (2024-08)
PubMed: 38945214
FOXO1 regulates RUNX2 ubiquitination through SMURF2 in calcific aortic valve disease.
Jiang Chen, Yao Dingyi, Liu Zongtao, Zheng Yidan, Chen Ming, Yim Wai Yen, Zheng Qiang, Zhang Tailong, Fan Lin, Fan Zhengfeng, Geng Bingchuan, Tian Rui, Zhou Tingwen, Qiao Weihua, Shi Jiawei, Li Fei, Xu Li, Huang Yuming, Dong Nianguo
Redox biology  (2024-07)
PubMed: 38810422
Flavin containing monooxygenase 2 regulates renal tubular cell fibrosis and paracrine secretion via SMURF2 in AKI‑CKD transformation.
Wang Longfei, Zha Hongchu, Huang Jing, Shi Lang
International journal of molecular medicine  (2023-11)
PubMed: 37800598
Loss of SMURF2 expression enhances RACK1 stability and promotes ovarian cancer progression.
Pi Yanan, Feng Qiushi, Sun Fusheng, Wang Zhiqiang, Zhao Yue, Chen Dejia, Liu Yiming, Lou Ge
Cell death and differentiation  (2023-11)
PubMed: 37828084
Deep quantitative glycoproteomics reveals gut microbiome induced remodeling of the brain glycoproteome
Potel C.M., Burtscher M.L., Garrido-Rodriguez M., Brauer-Nikonow A., Becher I., Typas A., Zimmermann M., Savitski M.
bioRxiv  (2023)
DOI: 10.1101/2023.09.13.557529
Smurf2-Mediated Ubiquitination of FOXO4 Regulates Oxygen-glucose Deprivation/Reperfusion-induced Pyroptosis of Cortical Neurons.
Yan Bin, Jin Yan, Mao Song, Zhang Yi, Yang Dahong, Du Mingyang, Yin Yugang
Current neurovascular research  (2023)
PubMed: 37861000
Direct identification of HLA class I and class II-restricted T cell epitopes in pancreatic cancer tissues by mass spectrometry.
Fujiwara Kenji, Shao Yingkuan, Niu Nan, Zhang Tengyi, Herbst Brian, Henderson Mackenzie, Muth Stephen, Zhang Pingbo, Zheng Lei
Journal of hematology & oncology  (2022-10-25)
PubMed: 36284347
Immunopeptidomics-based design of mRNA vaccine formulations against Listeria monocytogenes.
Mayer Rupert L, Verbeke Rein, Asselman Caroline, Aernout Ilke, Gul Adillah, Eggermont Denzel, Boucher Katie, Thery Fabien, Maia Teresa M, Demol Hans, Gabriels Ralf, Martens Lennart, Bécavin Christophe, De Smedt Stefaan C, Vandekerckhove Bart, Lentacker Ine, Impens Francis
Nature communications  (2022-10-14)
PubMed: 36241641
Tumour-associated antigenic peptides are present in the HLA class I ligandome of cancer cell line derived extracellular vesicles.
Kumar Pankaj, Boyne Caitlin, Brown Sydney, Qureshi Ayesha, Thorpe Peter, Synowsky Silvia A, Shirran Sally, Powis Simon J
Immunology  (2022-06)
PubMed: 35318648
Soluble HLA peptidome of pleural effusions is a valuable source for tumor antigens.
Khazan-Kost Sofia, Cafri Gal, Melamed Kadosh Dganit, Mooshayef Navit, Chatterji Sumit, Dominissini Dan, Manor Sigal, Zisser Bracha, Broday Limor, Talalai Efrosiniia, Shemer Anat, Zadok Oranit, Ofek Efrat, Onn Amir, Admon Arie, Peled Michael
Journal for immunotherapy of cancer  (2022-05)
PubMed: 35580925
Immunopeptidomic analysis of influenza A virus infected human tissues identifies internal proteins as a rich source of HLA ligands.
Nicholas Ben, Bailey Alistair, Staples Karl J, Wilkinson Tom, Elliott Tim, Skipp Paul
PLoS pathogens  (2022-01)
PubMed: 35051231
SMURF2 phosphorylation at Thr249 modifies glioma stemness and tumorigenicity by regulating TGF-beta receptor stability.
Hiraiwa M, Fukasawa K, Iezaki T, Sabit H, Horie T, Tokumura K, Iwahashi S, Murata M, Kobayashi M, Suzuki A, Park G, Kaneda K, Todo T, Hirao A, Nakada M, Hinoi E
Communications biology  (2022)
PubMed: 35017630
HLA class II immunopeptidomics reveals that co-inherited HLA-allotypes within an extended haplotype can improve proteome coverage for immunosurveillance.
Ramarathinam Sri H, Ho Bosco K, Dudek Nadine L, Purcell Anthony W
Proteomics  (2021-09)
PubMed: 34357683
NMD inhibition by 5-azacytidine augments presentation of immunogenic frameshift-derived neoepitopes.
Becker Jonas P, Helm Dominic, Rettel Mandy, Stein Frank, Hernandez-Sanchez Alejandro, Urban Katharina, Gebert Johannes, Kloor Matthias, Neu-Yilik Gabriele, von Knebel Doeberitz Magnus, Hentze Matthias W, Kulozik Andreas E
iScience  (2021-04-23)
PubMed: 33981976
CIITA-Transduced Glioblastoma Cells Uncover a Rich Repertoire of Clinically Relevant Tumor-Associated HLA-II Antigens.
Forlani Greta, Michaux Justine, Pak HuiSong, Huber Florian, Marie Joseph Elodie Lauret, Ramia Elise, Stevenson Brian J, Linnebacher Michael, Accolla Roberto S, Bassani-Sternberg Michal
Molecular & cellular proteomics : MCP  (2021)
PubMed: 33592498
Ubiquitin Ligase SMURF2 Interacts with Filovirus VP40 and Promotes Egress of VP40 VLPs.
Shepley-McTaggart A, Schwoerer MP, Sagum CA, Bedford MT, Jaladanki CK, Fan H, Cassel J, Harty RN
Viruses  (2021)
PubMed: 33673144
IFNγ Modulates the Immunopeptidome of Triple Negative Breast Cancer Cells by Enhancing and Diversifying Antigen Processing and Presentation.
Goncalves Gabriel, Mullan Kerry A, Duscharla Divya, Ayala Rochelle, Croft Nathan P, Faridi Pouya, Purcell Anthony W
Frontiers in immunology  (2021)
PubMed: 33968037
Immunopeptidogenomics: Harnessing RNA-Seq to Illuminate the Dark Immunopeptidome.
Scull Katherine E, Pandey Kirti, Ramarathinam Sri H, Purcell Anthony W
Molecular & cellular proteomics : MCP  (2021)
PubMed: 34509645
Thermostability profiling of MHC-bound peptides: a new dimension in immunopeptidomics and aid for immunotherapy design.
Jappe Emma C, Garde Christian, Ramarathinam Sri H, Passantino Ethan, Illing Patricia T, Mifsud Nicole A, Trolle Thomas, Kringelum Jens V, Croft Nathan P, Purcell Anthony W
Nature communications  (2020-12-09)
PubMed: 33298915
Spliced Peptides and Cytokine-Driven Changes in the Immunopeptidome of Melanoma.
Faridi Pouya, Woods Katherine, Ostrouska Simone, Deceneux Cyril, Aranha Ritchlynn, Duscharla Divya, Wong Stephen Q, Chen Weisan, Ramarathinam Sri H, Lim Kam Sian Terry C C, Croft Nathan P, Li Chen, Ayala Rochelle, Cebon Jonathan S, Purcell Anthony W, Schittenhelm Ralf B, Behren Andreas
Cancer immunology research  (2020-10)
PubMed: 32938616
Immunopeptidomic Analysis Reveals That Deamidated HLA-bound Peptides Arise Predominantly from Deglycosylated Precursors.
Mei Shutao, Ayala Rochelle, Ramarathinam Sri H, Illing Patricia T, Faridi Pouya, Song Jiangning, Purcell Anthony W, Croft Nathan P
Molecular & cellular proteomics : MCP  (2020-07)
PubMed: 32357974
In-depth mining of the immunopeptidome of an acute myeloid leukemia cell line using complementary ligand enrichment and data acquisition strategies.
Pandey Kirti, Mifsud Nicole A, Lim Kam Sian Terry C C, Ayala Rochelle, Ternette Nicola, Ramarathinam Sri H, Purcell Anthony W
Molecular immunology  (2020-07)
PubMed: 32387766
Multiplexed relative and absolute quantitative immunopeptidomics reveals MHC I repertoire alterations induced by CDK4/6 inhibition.
Stopfer Lauren E, Mesfin Joshua M, Joughin Brian A, Lauffenburger Douglas A, White Forest M
Nature communications  (2020-06-02)
PubMed: 32488085
Identification of an Unconventional Subpeptidome Bound to the Behçet's Disease-associated HLA-B*51:01 that is Regulated by Endoplasmic Reticulum Aminopeptidase 1 (ERAP1).
Chen Liye, Shi Hui, Koftori Danai, Sekine Takuya, Nicastri Annalisa, Ternette Nicola, Bowness Paul
Molecular & cellular proteomics : MCP  (2020-05)
PubMed: 32161166
Integrated proteogenomic deep sequencing and analytics accurately identify non-canonical peptides in tumor immunopeptidomes.
Chong Chloe, Müller Markus, Pak HuiSong, Harnett Dermot, Huber Florian, Grun Delphine, Leleu Marion, Auger Aymeric, Arnaud Marion, Stevenson Brian J, Michaux Justine, Bilic Ilija, Hirsekorn Antje, Calviello Lorenzo, Simó-Riudalbas Laia, Planet Evarist, Lubiński Jan, Bryśkiewicz Marta, Wiznerowicz Maciej, Xenarios Ioannis, Zhang Lin, Trono Didier, Harari Alexandre, Ohler Uwe, Coukos George, Bassani-Sternberg Michal
Nature communications  (2020-03-10)
PubMed: 32157095
A large peptidome dataset improves HLA class I epitope prediction across most of the human population.
Sarkizova Siranush, Klaeger Susan, Le Phuong M, Li Letitia W, Oliveira Giacomo, Keshishian Hasmik, Hartigan Christina R, Zhang Wandi, Braun David A, Ligon Keith L, Bachireddy Pavan, Zervantonakis Ioannis K, Rosenbluth Jennifer M, Ouspenskaia Tamara, Law Travis, Justesen Sune, Stevens Jonathan, Lane William J, Eisenhaure Thomas, Lan Zhang Guang, Clauser Karl R, Hacohen Nir, Carr Steven A, Wu Catherine J, Keskin Derin B
Nature biotechnology  (2020-02)
PubMed: 31844290
Mass Spectrometry Based Immunopeptidomics Leads to Robust Predictions of Phosphorylated HLA Class I Ligands.
Solleder Marthe, Guillaume Philippe, Racle Julien, Michaux Justine, Pak Hui-Song, Müller Markus, Coukos George, Bassani-Sternberg Michal, Gfeller David
Molecular & cellular proteomics : MCP  (2020-02)
PubMed: 31848261
c-Met activation leads to the establishment of a TGFβ-receptor regulatory network in bladder cancer progression.
Sim Wen Jing, Iyengar Prasanna Vasudevan, Lama Dilraj, Lui Sarah Kit Leng, Ng Hsien Chun, Haviv-Shapira Lior, Domany Eytan, Kappei Dennis, Tan Tuan Zea, Saei Azad, Jaynes Patrick William, Verma Chandra Shekhar, Kumar Alan Prem, Rouanne Mathieu, Ha Hong Koo, Radulescu Camelia, Ten Dijke Peter, Eichhorn Pieter Johan Adam, Thiery Jean Paul
Nature communications  (2019-09-25)
PubMed: 31554791
Identification of Immunodominant HIV-1 Epitopes Presented by HLA-C*12:02, a Protective Allele, Using an Immunopeptidomics Approach.
Chikata Takayuki, Paes Wayne, Akahoshi Tomohiro, Partridge Thomas, Murakoshi Hayato, Gatanaga Hiroyuki, Ternette Nicola, Oka Shinichi, Borrow Persephone, Takiguchi Masafumi
Journal of virology  (2019-09-01)
PubMed: 31217245
TTC3 contributes to TGF-beta1-induced epithelial-mesenchymal transition and myofibroblast differentiation, potentially through SMURF2 ubiquitylation and degradation.
Kim JH, Ham S, Lee Y, Suh GY, Lee YS
Cell death & disease  (2019)
PubMed: 30696809
TRAF4 positively regulates the osteogenic differentiation of mesenchymal stem cells by acting as an E3 ubiquitin ligase to degrade Smurf2.
Li J, Wang P, Xie Z, Wang S, Cen S, Li M, Liu W, Tang S, Ye G, Zheng G, Su H, Ma M, Wu X, Wu Y, Shen H
Cell death and differentiation  (2019)
PubMed: 31076633
Immunopeptidomic Profiling of HLA-A2-Positive Triple Negative Breast Cancer Identifies Potential Immunotherapy Target Antigens.
Ternette Nicola, Olde Nordkamp Marloes J M, Müller Julius, Anderson Amanda P, Nicastri Annalisa, Hill Adrian V S, Kessler Benedikt M, Li Demin
Proteomics  (2018-06)
PubMed: 29786170
Thrombin promotes PAI-1 expression and migration in keratinocytes via ERK dependent Smad linker region phosphorylation.
Talati N, Kamato D, Piva TJ, Little PJ, Osman N
Cellular signalling  (2018)
PubMed: 29577978
Unveiling the Peptide Motifs of HLA-C and HLA-G from Naturally Presented Peptides and Generation of Binding Prediction Matrices.
Di Marco Moreno, Schuster Heiko, Backert Linus, Ghosh Michael, Rammensee Hans-Georg, Stevanović Stefan
Journal of immunology (Baltimore, Md. : 1950)  (2017-10-15)
PubMed: 28904123
Mass Spectrometry Profiling of HLA-Associated Peptidomes in Mono-allelic Cells Enables More Accurate Epitope Prediction.
Abelin Jennifer G, Keskin Derin B, Sarkizova Siranush, Hartigan Christina R, Zhang Wandi, Sidney John, Stevens Jonathan, Lane William, Zhang Guang Lan, Eisenhaure Thomas M, Clauser Karl R, Hacohen Nir, Rooney Michael S, Carr Steven A, Wu Catherine J
Immunity  (2017-02-21)
PubMed: 28228285
A large fraction of HLA class I ligands are proteasome-generated spliced peptides.
Liepe Juliane, Marino Fabio, Sidney John, Jeko Anita, Bunting Daniel E, Sette Alessandro, Kloetzel Peter M, Stumpf Michael P H, Heck Albert J R, Mishto Michele
Science (New York, N.Y.)  (2016-10-21)
PubMed: 27846572
The role of specific Smad linker region phosphorylation in TGF-beta mediated expression of glycosaminoglycan synthesizing enzymes in vascular smooth muscle.
Rostam MA, Kamato D, Piva TJ, Zheng W, Little PJ, Osman N
Cellular signalling  (2016)
PubMed: 27153775
Mass spectrometry of human leukocyte antigen class I peptidomes reveals strong effects of protein abundance and turnover on antigen presentation.
Bassani-Sternberg Michal, Pletscher-Frankild Sune, Jensen Lars Juhl, Mann Matthias
Molecular & cellular proteomics : MCP  (2015-03)
PubMed: 25576301
Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery
Campos D., Freitas D., Gomes J., Magalhães A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.
Molecular & Cellular Proteomics  (2015)
DOI: 10.1074/mcp.M114.046862
The deubiquitinating enzyme USP24 is a regulator of the UV damage response.
Zhang L, Nemzow L, Chen H, Lubin A, Rong X, Sun Z, Harris TK, Gong F
Cell reports  (2015)
PubMed: 25578727
Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.
Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA
Molecular & cellular proteomics : MCP  (2015)
PubMed: 25813380
USP21 negatively regulates antiviral response by acting as a RIG-I deubiquitinase.
Fan Y, Mao R, Yu Y, Liu S, Shi Z, Cheng J, Zhang H, An L, Zhao Y, Xu X, Chen Z, Kogiso M, Zhang D, Zhang H, Zhang P, Jung JU, Li X, Xu G, Yang J
The Journal of experimental medicine  (2014)
PubMed: 24493797
EFCAB7 and IQCE regulate hedgehog signaling by tethering the EVC-EVC2 complex to the base of primary cilia.
Pusapati GV, Hughes CE, Dorn KV, Zhang D, Sugianto P, Aravind L, Rohatgi R
Developmental cell  (2014)
PubMed: 24582806
G-protein-coupled receptors, Hedgehog signaling and primary cilia.
Mukhopadhyay S, Rohatgi R
Seminars in cell & developmental biology  (2014)
PubMed: 24845016
Overlapping binding sites for importin beta1 and suppressor of fused (SuFu) on glioma-associated oncogene homologue 1 (Gli1) regulate its nuclear localization.
Szczepny A, Wagstaff KM, Dias M, Gajewska K, Wang C, Davies RG, Kaur G, Ly-Huynh J, Loveland KL, Jans DA
The Biochemical journal  (2014)
PubMed: 24854174
The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy.
Bingol B, Tea JS, Phu L, Reichelt M, Bakalarski CE, Song Q, Foreman O, Kirkpatrick DS, Sheng M
Nature  (2014)
PubMed: 24896179
Requirement of Smurf-mediated endocytosis of Patched1 in sonic hedgehog signal reception.
Yue S, Tang LY, Tang Y, Tang Y, Shen QH, Ding J, Chen Y, Zhang Z, Yu TT, Zhang YE, Cheng SY
eLife  (2014)
PubMed: 24925320
Deubiquitination and stabilization of IL-33 by USP21.
Tao L, Chen C, Song H, Piccioni M, Shi G, Li B
International journal of clinical and experimental pathology  (2014)
PubMed: 25197364
The histone H2A deubiquitinase USP16 interacts with HERC2 and fine-tunes cellular response to DNA damage.
Zhang Z, Yang H, Wang H
The Journal of biological chemistry  (2014)
PubMed: 25305019
The many roles of the conserved eukaryotic Paf1 complex in regulating transcription, histone modifications, and disease states.
Tomson BN, Arndt KM
Biochimica et biophysica acta  (2013)
PubMed: 22982193
The ciliary G-protein-coupled receptor Gpr161 negatively regulates the Sonic hedgehog pathway via cAMP signaling.
Mukhopadhyay S, Wen X, Ratti N, Loktev A, Rangell L, Scales SJ, Jackson PK
Cell  (2013)
PubMed: 23332756
CBFbeta stabilizes HIV Vif to counteract APOBEC3 at the expense of RUNX1 target gene expression.
Kim DY, Kwon E, Hartley PD, Crosby DC, Mann S, Krogan NJ, Gross JD
Molecular cell  (2013)
PubMed: 23333304
Identification of the E3 deubiquitinase ubiquitin-specific peptidase 21 (USP21) as a positive regulator of the transcription factor GATA3.
Zhang J, Chen C, Hou X, Gao Y, Lin F, Yang J, Gao Z, Pan L, Tao L, Wen C, Yao Z, Tsun A, Shi G, Li B
The Journal of biological chemistry  (2013)
PubMed: 23395819
USP33 regulates centrosome biogenesis via deubiquitination of the centriolar protein CP110.
Li J, D'Angiolella V, Seeley ES, Kim S, Kobayashi T, Fu W, Campos EI, Pagano M, Dynlacht BD
Nature  (2013)
PubMed: 23486064
The Par3/Par6/aPKC complex and epithelial cell polarity.
Chen J, Zhang M
Experimental cell research  (2013)
PubMed: 23535009
The mechanisms of Hedgehog signalling and its roles in development and disease.
Briscoe J, Therond PP
Nature reviews. Molecular cell biology  (2013)
PubMed: 23719536
Hedgehog signaling from the primary cilium to the nucleus: an emerging picture of ciliary localization, trafficking and transduction.
Nozawa YI, Lin C, Chuang PT
Current opinion in genetics & development  (2013)
PubMed: 23725801
USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.
Zhang Z, Jones A, Joo HY, Zhou D, Cao Y, Chen S, Erdjument-Bromage H, Renfrow M, He H, Tempst P, Townes TM, Giles KE, Ma L, Wang H
Genes & development  (2013)
PubMed: 23824326
USP18 inhibits NF-kappaB and NFAT activation during Th17 differentiation by deubiquitinating the TAK1-TAB1 complex.
Liu X, Li H, Zhong B, Blonska M, Gorjestani S, Yan M, Tian Q, Zhang DE, Lin X, Dong C
The Journal of experimental medicine  (2013)
PubMed: 23825189
Centrosomal protein DZIP1 regulates Hedgehog signaling by promoting cytoplasmic retention of transcription factor GLI3 and affecting ciliogenesis.
Wang C, Low WC, Liu A, Wang B
The Journal of biological chemistry  (2013)
PubMed: 23955340
Deubiquitinating enzyme Usp12 is a novel co-activator of the androgen receptor.
Burska UL, Harle VJ, Coffey K, Darby S, Ramsey H, O'Neill D, Logan IR, Gaughan L, Robson CN
The Journal of biological chemistry  (2013)
PubMed: 24056413
Stabilization of speckle-type POZ protein (Spop) by Daz interacting protein 1 (Dzip1) is essential for Gli turnover and the proper output of Hedgehog signaling.
Schwend T, Jin Z, Jiang K, Mitchell BJ, Jia J, Yang J
The Journal of biological chemistry  (2013)
PubMed: 24072710
Ubiquitin-specific proteases 25 negatively regulates virus-induced type I interferon signaling.
Zhong H, Wang D, Fang L, Zhang H, Luo R, Shang M, Ouyang C, Ouyang H, Chen H, Xiao S
PloS one  (2013)
PubMed: 24260525
Activation of Smurf E3 ligase promoted by smoothened regulates hedgehog signaling through targeting patched turnover.
Huang S, Zhang Z, Zhang C, Lv X, Zheng X, Chen Z, Sun L, Wang H, Zhu Y, Zhang J, Yang S, Lu Y, Sun Q, Tao Y, Liu F, Zhao Y, Chen D
PLoS biology  (2013)
PubMed: 24302888
Ubiquitin-specific protease 4 (USP4) targets TRAF2 and TRAF6 for deubiquitination and inhibits TNFalpha-induced cancer cell migration.
Xiao N, Li H, Luo J, Wang R, Chen H, Chen J, Wang P
The Biochemical journal  (2012)
PubMed: 22029577
Ubiquitin-specific protease 19 (USP19) regulates hypoxia-inducible factor 1alpha (HIF-1alpha) during hypoxia.
Altun M, Zhao B, Velasco K, Liu H, Hassink G, Paschke J, Pereira T, Lindsten K
The Journal of biological chemistry  (2012)
PubMed: 22128162
USP15 stabilizes TGF-beta receptor I and promotes oncogenesis through the activation of TGF-beta signaling in glioblastoma.
Eichhorn PJ, Rodon L, Gonzalez-Junca A, Dirac A, Gili M, Martinez-Saez E, Aura C, Barba I, Peg V, Prat A, Cuartas I, Jimenez J, Garcia-Dorado D, Sahuquillo J, Bernards R, Baselga J, Seoane J
Nature medicine  (2012)
PubMed: 22344298
Mammalian homologues of Drosophila fused kinase.
Maloverjan A, Piirsoo M
Vitamins and hormones  (2012)
PubMed: 22391301
A novel tankyrase inhibitor decreases canonical Wnt signaling in colon carcinoma cells and reduces tumor growth in conditional APC mutant mice.
Waaler J, Machon O, Tumova L, Dinh H, Korinek V, Wilson SR, Paulsen JE, Pedersen NM, Eide TJ, Machonova O, Gradl D, Voronkov A, von Kries JP, Krauss S
Cancer research  (2012)
PubMed: 22440753
Planar cell polarity in the inner ear.
May-Simera H, Kelley MW
Current topics in developmental biology  (2012)
PubMed: 23140627
Inhibition of tankyrases induces Axin stabilization and blocks Wnt signalling in breast cancer cells.
Bao R, Christova T, Song S, Angers S, Yan X, Attisano L
PloS one  (2012)
PubMed: 23144924
The deubiquitinating protein USP24 interacts with DDB2 and regulates DDB2 stability.
Zhang L, Lubin A, Chen H, Sun Z, Gong F
Cell cycle (Georgetown, Tex.)  (2012)
PubMed: 23159851
Numb activates the E3 ligase Itch to control Gli1 function through a novel degradation signal.
Di Marcotullio L, Greco A, Mazza D, Canettieri G, Pietrosanti L, Infante P, Coni S, Moretti M, De Smaele E, Ferretti E, Screpanti I, Gulino A
Oncogene  (2011)
PubMed: 20818436
Lys-63-specific deubiquitination of SDS3 by USP17 regulates HDAC activity.
Ramakrishna S, Suresh B, Lee EJ, Lee HJ, Ahn WS, Baek KH
The Journal of biological chemistry  (2011)
PubMed: 21239494
USP47 is a deubiquitylating enzyme that regulates base excision repair by controlling steady-state levels of DNA polymerase beta.
Parsons JL, Dianova II, Khoronenkova SV, Edelmann MJ, Kessler BM, Dianov GL
Molecular cell  (2011)
PubMed: 21362556
RNF146 is a poly(ADP-ribose)-directed E3 ligase that regulates axin degradation and Wnt signalling.
Zhang Y, Liu S, Mickanin C, Feng Y, Charlat O, Michaud GA, Schirle M, Shi X, Hild M, Bauer A, Myer VE, Finan PM, Porter JA, Huang SM, Cong F
Nature cell biology  (2011)
PubMed: 21478859
Ubiquitin-recognition protein Ufd1 couples the endoplasmic reticulum (ER) stress response to cell cycle control.
Chen M, Gutierrez GJ, Ronai ZA
Proceedings of the National Academy of Sciences of the United States of America  (2011)
PubMed: 21571647
SCFFBXL(1)(5) regulates BMP signalling by directing the degradation of HECT-type ubiquitin ligase Smurf1.
Cui Y, He S, Xing C, Lu K, Wang J, Xing G, Meng A, Jia S, He F, Zhang L
The EMBO journal  (2011)
PubMed: 21572392
Deubiquitinase USP37 is activated by CDK2 to antagonize APC(CDH1) and promote S phase entry.
Huang X, Summers MK, Pham V, Lill JR, Liu J, Lee G, Kirkpatrick DS, Jackson PK, Fang G, Dixit VM
Molecular cell  (2011)
PubMed: 21596315
USP13 enzyme regulates Siah2 ligase stability and activity via noncatalytic ubiquitin-binding domains.
Scortegagna M, Subtil T, Qi J, Kim H, Zhao W, Gu W, Kluger H, Ronai ZA
The Journal of biological chemistry  (2011)
PubMed: 21659512
Sonic Hedgehog dependent phosphorylation by CK1alpha and GRK2 is required for ciliary accumulation and activation of smoothened.
Chen Y, Sasai N, Ma G, Yue T, Jia J, Briscoe J, Jiang J
PLoS biology  (2011)
PubMed: 21695114
TSC-22 promotes transforming growth factor beta-mediated cardiac myofibroblast differentiation by antagonizing Smad7 activity.
Yan X, Zhang J, Pan L, Wang P, Xue H, Zhang L, Gao X, Zhao X, Ning Y, Chen YG
Molecular and cellular biology  (2011)
PubMed: 21791611
Ubiquitin ligase RNF146 regulates tankyrase and Axin to promote Wnt signaling.
Callow MG, Tran H, Phu L, Lau T, Lee J, Sandoval WN, Liu PS, Bheddah S, Tao J, Lill JR, Hongo JA, Davis D, Kirkpatrick DS, Polakis P, Costa M
PloS one  (2011)
PubMed: 21799911
Gli proteins in development and disease.
Hui CC, Angers S
Annual review of cell and developmental biology  (2011)
PubMed: 21801010
The USP19 deubiquitinase regulates the stability of c-IAP1 and c-IAP2.
Mei Y, Hahn AA, Hu S, Yang X
The Journal of biological chemistry  (2011)
PubMed: 21849505
The antagonistic action of B56-containing protein phosphatase 2As and casein kinase 2 controls the phosphorylation and Gli turnover function of Daz interacting protein 1.
Jin Z, Mei W, Strack S, Jia J, Yang J
The Journal of biological chemistry  (2011)
PubMed: 21878643
Beclin1 controls the levels of p53 by regulating the deubiquitination activity of USP10 and USP13.
Liu J, Xia H, Kim M, Xu L, Li Y, Zhang L, Cai Y, Norberg HV, Zhang T, Furuya T, Jin M, Zhu Z, Wang H, Yu J, Li Y, Hao Y, Choi A, Ke H, Ma D, Yuan J
Cell  (2011)
PubMed: 21962518
Planar cell polarity in Drosophila.
Maung SM, Jenny A
Organogenesis  (2011)
PubMed: 21983142
Protein kinase A acts at the basal body of the primary cilium to prevent Gli2 activation and ventralization of the mouse neural tube.
Tuson M, He M, Anderson KV
Development (Cambridge, England)  (2011)
PubMed: 22007132
Ablation of Smurf2 reveals an inhibition in TGF-beta signalling through multiple mono-ubiquitination of Smad3.
Tang LY, Yamashita M, Coussens NP, Tang Y, Wang X, Li C, Deng CX, Cheng SY, Zhang YE
The EMBO journal  (2011)
PubMed: 22045334
Regulation of p53 stability and function by the deubiquitinating enzyme USP42.
Hock AK, Vigneron AM, Carter S, Ludwig RL, Vousden KH
The EMBO journal  (2011)
PubMed: 22085928
Domain analysis reveals that a deubiquitinating enzyme USP13 performs non-activating catalysis for Lys63-linked polyubiquitin.
Zhang YH, Zhou CJ, Zhou ZR, Song AX, Hu HY
PloS one  (2011)
PubMed: 22216260
MdmX is a substrate for the deubiquitinating enzyme USP2a.
Allende-Vega N, Sparks A, Lane DP, Saville MK
Oncogene  (2010)
PubMed: 19838211
The Zn finger protein Iguana impacts Hedgehog signaling by promoting ciliogenesis.
Glazer AM, Wilkinson AW, Backer CB, Lapan SW, Gutzman JH, Cheeseman IM, Reddien PW
Developmental biology  (2010)
PubMed: 19852954
USP11 negatively regulates TNFalpha-induced NF-kappaB activation by targeting on IkappaBalpha.
Sun W, Tan X, Shi Y, Xu G, Mao R, Gu X, Fan Y, Yu Y, Burlingame S, Zhang H, Rednam SP, Lu X, Zhang T, Fu S, Cao G, Qin J, Yang J
Cellular signalling  (2010)
PubMed: 19874889
Identification of a novel serine/threonine kinase ULK3 as a positive regulator of Hedgehog pathway.
Maloverjan A, Piirsoo M, Michelson P, Kogerman P, Osterlund T
Experimental cell research  (2010)
PubMed: 19878745
Ubiquitin-specific peptidase 21 inhibits tumor necrosis factor alpha-induced nuclear factor kappaB activation via binding to and deubiquitinating receptor-interacting protein 1.
Xu G, Tan X, Wang H, Sun W, Shi Y, Burlingame S, Gu X, Cao G, Zhang T, Qin J, Yang J
The Journal of biological chemistry  (2010)
PubMed: 19910467
The family of ubiquitin-conjugating enzymes (E2s): deciding between life and death of proteins.
van Wijk SJ, Timmers HT
FASEB journal : official publication of the Federation of American Societies for Experimental Biology  (2010)
PubMed: 19940261
The iguana/DZIP1 protein is a novel component of the ciliogenic pathway essential for axonemal biogenesis.
Tay SY, Yu X, Wong KN, Panse P, Ng CP, Roy S
Developmental dynamics : an official publication of the American Association of Anatomists  (2010)
PubMed: 20014402
Sonic-hedgehog-mediated proliferation requires the localization of PKA to the cilium base.
Barzi M, Berenguer J, Menendez A, Alvarez-Rodriguez R, Pons S
Journal of cell science  (2010)
PubMed: 20016067
MTMR4 attenuates transforming growth factor beta (TGFbeta) signaling by dephosphorylating R-Smads in endosomes.
Yu J, Pan L, Qin X, Chen H, Xu Y, Chen Y, Tang H
The Journal of biological chemistry  (2010)
PubMed: 20061380
USP10 regulates p53 localization and stability by deubiquitinating p53.
Yuan J, Luo K, Zhang L, Cheville JC, Lou Z
Cell  (2010)
PubMed: 20096447
Src kinase phosphorylates RUNX3 at tyrosine residues and localizes the protein in the cytoplasm.
Goh YM, Cinghu S, Hong ET, Lee YS, Kim JH, Jang JW, Li YH, Chi XZ, Lee KS, Wee H, Ito Y, Oh BC, Bae SC
The Journal of biological chemistry  (2010)
PubMed: 20100835
TMEPAI, a transmembrane TGF-beta-inducible protein, sequesters Smad proteins from active participation in TGF-beta signaling.
Watanabe Y, Itoh S, Goto T, Ohnishi E, Inamitsu M, Itoh F, Satoh K, Wiercinska E, Yang W, Shi L, Tanaka A, Nakano N, Mommaas AM, Shibuya H, Ten Dijke P, Kato M
Molecular cell  (2010)
PubMed: 20129061
Kinetics of hedgehog-dependent full-length Gli3 accumulation in primary cilia and subsequent degradation.
Wen X, Lai CK, Evangelista M, Hongo JA, de Sauvage FJ, Scales SJ
Molecular and cellular biology  (2010)
PubMed: 20154143
Ubiquitin hydrolase Dub3 promotes oncogenic transformation by stabilizing Cdc25A.
Pereg Y, Liu BY, O'Rourke KM, Sagolla M, Dey A, Komuves L, French DM, Dixit VM
Nature cell biology  (2010)
PubMed: 20228808
The output of Hedgehog signaling is controlled by the dynamic association between Suppressor of Fused and the Gli proteins.
Humke EW, Dorn KV, Milenkovic L, Scott MP, Rohatgi R
Genes & development  (2010)
PubMed: 20360384
The ubiquitin-specific protease 17 is involved in virus-triggered type I IFN signaling.
Chen R, Zhang L, Zhong B, Tan B, Liu Y, Shu HB
Cell research  (2010)
PubMed: 20368735
Hedgehog pathway-regulated gene networks in cerebellum development and tumorigenesis.
Lee EY, Ji H, Ouyang Z, Zhou B, Ma W, Vokes SA, McMahon AP, Wong WH, Scott MP
Proceedings of the National Academy of Sciences of the United States of America  (2010)
PubMed: 20460306
Gli2a protein localization reveals a role for Iguana/DZIP1 in primary ciliogenesis and a dependence of Hedgehog signal transduction on primary cilia in the zebrafish.
Kim HR, Richardson J, van Eeden F, Ingham PW
BMC biology  (2010)
PubMed: 20487519
The deubiquitinating enzyme USP26 is a regulator of androgen receptor signaling.
Dirac AM, Bernards R
Molecular cancer research : MCR  (2010)
PubMed: 20501646
DYRK1B-dependent autocrine-to-paracrine shift of Hedgehog signaling by mutant RAS.
Lauth M, Bergstrom A, Shimokawa T, Tostar U, Jin Q, Fendrich V, Guerra C, Barbacid M, Toftgard R
Nature structural & molecular biology  (2010)
PubMed: 20512148
Dual function of UNC-51-like kinase 3 (Ulk3) in the Sonic hedgehog signaling pathway.
Maloverjan A, Piirsoo M, Kasak L, Peil L, Osterlund T, Kogerman P
The Journal of biological chemistry  (2010)
PubMed: 20643644
G protein-coupled receptor kinase 2 promotes high-level Hedgehog signaling by regulating the active state of Smo through kinase-dependent and kinase-independent mechanisms in Drosophila.
Chen Y, Li S, Tong C, Zhao Y, Wang B, Liu Y, Jia J, Jiang J
Genes & development  (2010)
PubMed: 20844016
The protein stability of Axin, a negative regulator of Wnt signaling, is regulated by Smad ubiquitination regulatory factor 2 (Smurf2).
Kim S, Jho EH
The Journal of biological chemistry  (2010)
PubMed: 20858899
TULP3 bridges the IFT-A complex and membrane phosphoinositides to promote trafficking of G protein-coupled receptors into primary cilia.
Mukhopadhyay S, Wen X, Chih B, Nelson CD, Lane WS, Scales SJ, Jackson PK
Genes & development  (2010)
PubMed: 20889716
Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity.
Chong PA, Lin H, Wrana JL, Forman-Kay JD
Proceedings of the National Academy of Sciences of the United States of America  (2010)
PubMed: 20937913
A mechanism for vertebrate Hedgehog signaling: recruitment to cilia and dissociation of SuFu-Gli protein complexes.
Tukachinsky H, Lopez LV, Salic A
The Journal of cell biology  (2010)
PubMed: 20956384
PARP-1 attenuates Smad-mediated transcription.
Lonn P, van der Heide LP, Dahl M, Hellman U, Heldin CH, Moustakas A
Molecular cell  (2010)
PubMed: 21095583
USP19 deubiquitinating enzyme supports cell proliferation by stabilizing KPC1, a ubiquitin ligase for p27Kip1.
Lu Y, Adegoke OA, Nepveu A, Nakayama KI, Bedard N, Cheng D, Peng J, Wing SS
Molecular and cellular biology  (2009)
PubMed: 19015242
Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
Ebstein F, Lange N, Urban S, Seifert U, Kruger E, Kloetzel PM
The international journal of biochemistry & cell biology  (2009)
PubMed: 19028597
Small molecule-mediated disruption of Wnt-dependent signaling in tissue regeneration and cancer.
Chen B, Dodge ME, Tang W, Lu J, Ma Z, Fan CW, Wei S, Hao W, Kilgore J, Williams NS, Roth MG, Amatruda JF, Chen C, Lum L
Nature chemical biology  (2009)
PubMed: 19125156
FAM/USP9x, a deubiquitinating enzyme essential for TGFbeta signaling, controls Smad4 monoubiquitination.
Dupont S, Mamidi A, Cordenonsi M, Montagner M, Zacchigna L, Adorno M, Martello G, Stinchfield MJ, Soligo S, Morsut L, Inui M, Moro S, Modena N, Argenton F, Newfeld SJ, Piccolo S
Cell  (2009)
PubMed: 19135894
USP17 regulates Ras activation and cell proliferation by blocking RCE1 activity.
Burrows JF, Kelvin AA, McFarlane C, Burden RE, McGrattan MJ, De la Vega M, Govender U, Quinn DJ, Dib K, Gadina M, Scott CJ, Johnston JA
The Journal of biological chemistry  (2009)
PubMed: 19188362
Fused has evolved divergent roles in vertebrate Hedgehog signalling and motile ciliogenesis.
Wilson CW, Nguyen CT, Chen MH, Yang JH, Gacayan R, Huang J, Chen JN, Chuang PT
Nature  (2009)
PubMed: 19305393
Control of the activity of WW-HECT domain E3 ubiquitin ligases by NDFIP proteins.
Mund T, Pelham HR
EMBO reports  (2009)
PubMed: 19343052
Ubiquitin-like protein activation by E1 enzymes: the apex for downstream signalling pathways.
Schulman BA, Harper JW
Nature reviews. Molecular cell biology  (2009)
PubMed: 19352404
Beta-arrestin-dependent signaling and trafficking of 7-transmembrane receptors is reciprocally regulated by the deubiquitinase USP33 and the E3 ligase Mdm2.
Shenoy SK, Modi AS, Shukla AK, Xiao K, Berthouze M, Ahn S, Wilkinson KD, Miller WE, Lefkowitz RJ
Proceedings of the National Academy of Sciences of the United States of America  (2009)
PubMed: 19363159
The role of Parafibromin/Hyrax as a nuclear Gli/Ci-interacting protein in Hedgehog target gene control.
Mosimann C, Hausmann G, Basler K
Mechanisms of development  (2009)
PubMed: 19368795
Suppressor of Fused inhibits mammalian Hedgehog signaling in the absence of cilia.
Jia J, Kolterud A, Zeng H, Hoover A, Teglund S, Toftgard R, Liu A
Developmental biology  (2009)
PubMed: 19371734
Regulation of planar cell polarity by Smurf ubiquitin ligases.
Narimatsu M, Bose R, Pye M, Zhang L, Miller B, Ching P, Sakuma R, Luga V, Roncari L, Attisano L, Wrana JL
Cell  (2009)
PubMed: 19379695
The deubiquitinating enzyme USP10 regulates the post-endocytic sorting of cystic fibrosis transmembrane conductance regulator in airway epithelial cells.
Bomberger JM, Barnaby RL, Stanton BA
The Journal of biological chemistry  (2009)
PubMed: 19398555
The deubiquitinases USP33 and USP20 coordinate beta2 adrenergic receptor recycling and resensitization.
Berthouze M, Venkataramanan V, Li Y, Shenoy SK
The EMBO journal  (2009)
PubMed: 19424180
What was the set of ubiquitin and ubiquitin-like conjugating enzymes in the eukaryote common ancestor?
Michelle C, Vourc'h P, Mignon L, Andres CR
Journal of molecular evolution  (2009)
PubMed: 19452197
RING domain E3 ubiquitin ligases.
Deshaies RJ, Joazeiro CA
Annual review of biochemistry  (2009)
PubMed: 19489725
Identification of a SUFU germline mutation in a family with Gorlin syndrome.
Pastorino L, Ghiorzo P, Nasti S, Battistuzzi L, Cusano R, Marzocchi C, Garre ML, Clementi M, Scarra GB
American journal of medical genetics. Part A  (2009)
PubMed: 19533801
The kinesin protein Kif7 is a critical regulator of Gli transcription factors in mammalian hedgehog signaling.
Cheung HO, Zhang X, Ribeiro A, Mo R, Makino S, Puviindran V, Law KK, Briscoe J, Hui CC
Science signaling  (2009)
PubMed: 19549984
The mammalian Cos2 homolog Kif7 plays an essential role in modulating Hh signal transduction during development.
Endoh-Yamagami S, Evangelista M, Wilson D, Wen X, Theunissen JW, Phamluong K, Davis M, Scales SJ, Solloway MJ, de Sauvage FJ, Peterson AS
Current biology : CB  (2009)
PubMed: 19592253
Sufu recruits GSK3beta for efficient processing of Gli3.
Kise Y, Morinaka A, Teglund S, Miki H
Biochemical and biophysical research communications  (2009)
PubMed: 19622347
Mouse Kif7/Costal2 is a cilia-associated protein that regulates Sonic hedgehog signaling.
Liem KF Jr, He M, Ocbina PJ, Anderson KV
Proceedings of the National Academy of Sciences of the United States of America  (2009)
PubMed: 19666503
Cilium-independent regulation of Gli protein function by Sufu in Hedgehog signaling is evolutionarily conserved.
Chen MH, Wilson CW, Li YJ, Law KK, Lu CS, Gacayan R, Zhang X, Hui CC, Chuang PT
Genes & development  (2009)
PubMed: 19684112
Human BAMBI cooperates with Smad7 to inhibit transforming growth factor-beta signaling.
Yan X, Lin Z, Chen F, Zhao X, Chen H, Ning Y, Chen YG
The Journal of biological chemistry  (2009)
PubMed: 19758997
Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling.
Huang SM, Mishina YM, Liu S, Cheung A, Stegmeier F, Michaud GA, Charlat O, Wiellette E, Zhang Y, Wiessner S, Hild M, Shi X, Wilson CJ, Mickanin C, Myer V, Fazal A, Tomlinson R, Serluca F, Shao W, Cheng H, Shultz M, Rau C, Schirle M, Schlegl J, Ghidelli S, Fawell S, Lu C, Curtis D, Kirschner MW, Lengauer C, Finan PM, Tallarico JA, Bouwmeester T, Porter JA, Bauer A, Cong F
Nature  (2009)
PubMed: 19759537
Runt-related transcription factor RUNX3 is a target of MDM2-mediated ubiquitination.
Chi XZ, Kim J, Lee YH, Lee JW, Lee KS, Wee H, Kim WJ, Park WY, Oh BC, Stein GS, Ito Y, van Wijnen AJ, Bae SC
Cancer research  (2009)
PubMed: 19808967
Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
Zhuang M, Calabrese MF, Liu J, Waddell MB, Nourse A, Hammel M, Miller DJ, Walden H, Duda DM, Seyedin SN, Hoggard T, Harper JW, White KP, Schulman BA
Molecular cell  (2009)
PubMed: 19818708
Building ubiquitin chains: E2 enzymes at work.
Ye Y, Rape M
Nature reviews. Molecular cell biology  (2009)
PubMed: 19851334
Mechanisms of ubiquitin transfer by the anaphase-promoting complex.
Matyskiela ME, Rodrigo-Brenni MC, Morgan DO
Journal of biology  (2009)
PubMed: 19874575
Ubiquitin ligase Nedd4L targets activated Smad2/3 to limit TGF-beta signaling.
Gao S, Alarcon C, Sapkota G, Rahman S, Chen PY, Goerner N, Macias MJ, Erdjument-Bromage H, Tempst P, Massague J
Molecular cell  (2009)
PubMed: 19917253
Multiple Ser/Thr-rich degrons mediate the degradation of Ci/Gli by the Cul3-HIB/SPOP E3 ubiquitin ligase.
Zhang Q, Shi Q, Chen Y, Yue T, Li S, Wang B, Jiang J
Proceedings of the National Academy of Sciences of the United States of America  (2009)
PubMed: 19955409
Gli2 trafficking links Hedgehog-dependent activation of Smoothened in the primary cilium to transcriptional activation in the nucleus.
Kim J, Kato M, Beachy PA
Proceedings of the National Academy of Sciences of the United States of America  (2009)
PubMed: 19996169
Deubiquitylation of histone H2A activates transcriptional initiation via trans-histone cross-talk with H3K4 di- and trimethylation.
Nakagawa T, Kajitani T, Togo S, Masuko N, Ohdan H, Hishikawa Y, Koji T, Matsuyama T, Ikura T, Muramatsu M, Ito T
Genes & development  (2008)
PubMed: 18172164
AIMP1/p43 downregulates TGF-beta signaling via stabilization of smurf2.
Lee YS, Han JM, Son SH, Choi JW, Jeon EJ, Bae SC, Park YI, Kim S
Biochemical and biophysical research communications  (2008)
PubMed: 18448069
Application of active and kinase-deficient kinome collection for identification of kinases regulating hedgehog signaling.
Varjosalo M, Bjorklund M, Cheng F, Syvanen H, Kivioja T, Kilpinen S, Sun Z, Kallioniemi O, Stunnenberg HG, He WW, Ojala P, Taipale J
Cell  (2008)
PubMed: 18455992
Regulation of IkappaB kinase-related kinases and antiviral responses by tumor suppressor CYLD.
Zhang M, Wu X, Lee AJ, Jin W, Chang M, Wright A, Imaizumi T, Sun SC
The Journal of biological chemistry  (2008)
PubMed: 18467330
Beta-arrestin-mediated localization of smoothened to the primary cilium.
Kovacs JJ, Whalen EJ, Liu R, Xiao K, Kim J, Chen M, Wang J, Chen W, Lefkowitz RJ
Science (New York, N.Y.)  (2008)
PubMed: 18497258
TAZ controls Smad nucleocytoplasmic shuttling and regulates human embryonic stem-cell self-renewal.
Varelas X, Sakuma R, Samavarchi-Tehrani P, Peerani R, Rao BM, Dembowy J, Yaffe MB, Zandstra PW, Wrana JL
Nature cell biology  (2008)
PubMed: 18568018
Vasopressin-inducible ubiquitin-specific protease 10 increases ENaC cell surface expression by deubiquitylating and stabilizing sorting nexin 3.
Boulkroun S, Ruffieux-Daidie D, Vitagliano JJ, Poirot O, Charles RP, Lagnaz D, Firsov D, Kellenberger S, Staub O
American journal of physiology. Renal physiology  (2008)
PubMed: 18632802
The tumour suppressor CYLD is a negative regulator of RIG-I-mediated antiviral response.
Friedman CS, O'Donnell MA, Legarda-Addison D, Ng A, Cardenas WB, Yount JS, Moran TM, Basler CF, Komuro A, Horvath CM, Xavier R, Ting AT
EMBO reports  (2008)
PubMed: 18636086
Structural insights into E1-catalyzed ubiquitin activation and transfer to conjugating enzymes.
Lee I, Schindelin H
Cell  (2008)
PubMed: 18662542
Kinome siRNA screen identifies regulators of ciliogenesis and hedgehog signal transduction.
Evangelista M, Lim TY, Lee J, Parker L, Ashique A, Peterson AS, Ye W, Davis DP, de Sauvage FJ
Science signaling  (2008)
PubMed: 18827223
A genome-scale analysis of the cis-regulatory circuitry underlying sonic hedgehog-mediated patterning of the mammalian limb.
Vokes SA, Ji H, Wong WH, McMahon AP
Genes & development  (2008)
PubMed: 18832070
Identification of BMP9 and BMP10 as functional activators of the orphan activin receptor-like kinase 1 (ALK1) in endothelial cells.
David L, Mallet C, Mazerbourg S, Feige JJ, Bailly S
Blood  (2007)
PubMed: 17068149
The deubiquitinating enzyme USP2a regulates the p53 pathway by targeting Mdm2.
Stevenson LF, Sparks A, Allende-Vega N, Xirodimas DP, Lane DP, Saville MK
The EMBO journal  (2007)
PubMed: 17290220
BMP-9 signals via ALK1 and inhibits bFGF-induced endothelial cell proliferation and VEGF-stimulated angiogenesis.
Scharpfenecker M, van Dinther M, Liu Z, van Bezooijen RL, Zhao Q, Pukac L, Lowik CW, ten Dijke P
Journal of cell science  (2007)
PubMed: 17311849
Endofin acts as a Smad anchor for receptor activation in BMP signaling.
Shi W, Chang C, Nie S, Xie S, Wan M, Cao X
Journal of cell science  (2007)
PubMed: 17356069
Smad7 antagonizes transforming growth factor beta signaling in the nucleus by interfering with functional Smad-DNA complex formation.
Zhang S, Fei T, Zhang L, Zhang R, Chen F, Ning Y, Han Y, Feng XH, Meng A, Chen YG
Molecular and cellular biology  (2007)
PubMed: 17438144
Genomic characterization of Gli-activator targets in sonic hedgehog-mediated neural patterning.
Vokes SA, Ji H, McCuine S, Tenzen T, Giles S, Zhong S, Longabaugh WJ, Davidson EH, Wong WH, McMahon AP
Development (Cambridge, England)  (2007)
PubMed: 17442700
Anaphase initiation is regulated by antagonistic ubiquitination and deubiquitination activities.
Stegmeier F, Rape M, Draviam VM, Nalepa G, Sowa ME, Ang XL, McDonald ER 3rd, Li MZ, Hannon GJ, Sorger PK, Kirschner MW, Harper JW, Elledge SJ
Nature  (2007)
PubMed: 17443180
Arkadia induces degradation of SnoN and c-Ski to enhance transforming growth factor-beta signaling.
Nagano Y, Mavrakis KJ, Lee KL, Fujii T, Koinuma D, Sase H, Yuki K, Isogaya K, Saitoh M, Imamura T, Episkopou V, Miyazono K, Miyazawa K
The Journal of biological chemistry  (2007)
PubMed: 17510063
Arkadia activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation.
Levy L, Howell M, Das D, Harkin S, Episkopou V, Hill CS
Molecular and cellular biology  (2007)
PubMed: 17591695
Evolution of Na,K-ATPase beta m-subunit into a coregulator of transcription in placental mammals.
Pestov NB, Ahmad N, Korneenko TV, Zhao H, Radkov R, Schaer D, Roy S, Bibert S, Geering K, Modyanov NN
Proceedings of the National Academy of Sciences of the United States of America  (2007)
PubMed: 17592128
Patched1 regulates hedgehog signaling at the primary cilium.
Rohatgi R, Milenkovic L, Scott MP
Science (New York, N.Y.)  (2007)
PubMed: 17641202
Autoinhibition of the HECT-type ubiquitin ligase Smurf2 through its C2 domain.
Wiesner S, Ogunjimi AA, Wang HR, Rotin D, Sicheri F, Wrana JL, Forman-Kay JD
Cell  (2007)
PubMed: 17719543
Fbw7 and Usp28 regulate myc protein stability in response to DNA damage.
Popov N, Herold S, Llamazares M, Schulein C, Eilers M
Cell cycle (Georgetown, Tex.)  (2007)
PubMed: 17873522
Human USP3 is a chromatin modifier required for S phase progression and genome stability.
Nicassio F, Corrado N, Vissers JH, Areces LB, Bergink S, Marteijn JA, Geverts B, Houtsmuller AB, Vermeulen W, Di Fiore PP, Citterio E
Current biology : CB  (2007)
PubMed: 17980597
Regulation of early wave of germ cell apoptosis and spermatogenesis by deubiquitinating enzyme CYLD.
Wright A, Reiley WW, Chang M, Jin W, Lee AJ, Zhang M, Sun SC
Developmental cell  (2007)
PubMed: 17981138
Human ubiquitin specific protease 31 is a deubiquitinating enzyme implicated in activation of nuclear factor-kappaB.
Tzimas C, Michailidou G, Arsenakis M, Kieff E, Mosialos G, Hatzivassiliou EG
Cellular signalling  (2006)
PubMed: 16214042
Dual degradation signals control Gli protein stability and tumor formation.
Huntzicker EG, Estay IS, Zhen H, Lokteva LA, Jackson PK, Oro AE
Genes & development  (2006)
PubMed: 16421275
Divergence of hedgehog signal transduction mechanism between Drosophila and mammals.
Varjosalo M, Li SP, Taipale J
Developmental cell  (2006)
PubMed: 16459297
Genetic elimination of Suppressor of fused reveals an essential repressor function in the mammalian Hedgehog signaling pathway.
Svard J, Heby-Henricson K, Persson-Lek M, Rozell B, Lauth M, Bergstrom A, Ericson J, Toftgard R, Teglund S
Developmental cell  (2006)
PubMed: 16459298
Pleiotropic effects of ATP.Mg2+ binding in the catalytic cycle of ubiquitin-activating enzyme.
Tokgoz Z, Bohnsack RN, Haas AL
The Journal of biological chemistry  (2006)
PubMed: 16595681
Sonic hedgehog signaling regulates Gli2 transcriptional activity by suppressing its processing and degradation.
Pan Y, Bai CB, Joyner AL, Wang B
Molecular and cellular biology  (2006)
PubMed: 16611981
An expanded WW domain recognition motif revealed by the interaction between Smad7 and the E3 ubiquitin ligase Smurf2.
Chong P Andrew, Lin Hong, Wrana Jeffrey L, Forman-Kay Julie D
J. Biol. Chem.  (2006)
PubMed: 16641086
Roadkill attenuates Hedgehog responses through degradation of Cubitus interruptus.
Kent D, Bush EW, Hooper JE
Development (Cambridge, England)  (2006)
PubMed: 16651542
Structure of the ternary signaling complex of a TGF-beta superfamily member.
Allendorph GP, Vale WW, Choe S
Proceedings of the National Academy of Sciences of the United States of America  (2006)
PubMed: 16672363
Asymmetric localization of Vangl2 and Fz3 indicate novel mechanisms for planar cell polarity in mammals.
Montcouquiol M, Sans N, Huss D, Kach J, Dickman JD, Forge A, Rachel RA, Copeland NG, Jenkins NA, Bogani D, Murdoch J, Warchol ME, Wenthold RJ, Kelley MW
The Journal of neuroscience : the official journal of the Society for Neuroscience  (2006)
PubMed: 16687519
A hedgehog-induced BTB protein modulates hedgehog signaling by degrading Ci/Gli transcription factor.
Zhang Q, Zhang L, Wang B, Ou CY, Chien CT, Jiang J
Developmental cell  (2006)
PubMed: 16740475
PPM1A functions as a Smad phosphatase to terminate TGFbeta signaling.
Lin X, Duan X, Liang YY, Su Y, Wrighton KH, Long J, Hu M, Davis CM, Wang J, Brunicardi FC, Shi Y, Chen YG, Meng A, Feng XH
Cell  (2006)
PubMed: 16751101
Hematopoiesis controlled by distinct TIF1gamma and Smad4 branches of the TGFbeta pathway.
He W, Dorn DC, Erdjument-Bromage H, Tempst P, Moore MA, Massague J
Cell  (2006)
PubMed: 16751102
Tripeptidyl peptidase II is the major peptidase needed to trim long antigenic precursors, but is not required for most MHC class I antigen presentation.
York IA, Bhutani N, Zendzian S, Goldberg AL, Rock KL
Journal of immunology (Baltimore, Md. : 1950)  (2006)
PubMed: 16849449
Tankyrase recruitment to the lateral membrane in polarized epithelial cells: regulation by cell-cell contact and protein poly(ADP-ribosyl)ation.
Yeh TY, Meyer TN, Schwesinger C, Tsun ZY, Lee RM, Chi NW
The Biochemical journal  (2006)
PubMed: 16884355
A role for the deubiquitinating enzyme USP28 in control of the DNA-damage response.
Zhang D, Zaugg K, Mak TW, Elledge SJ
Cell  (2006)
PubMed: 16901786
A novel family of membrane-bound E3 ubiquitin ligases.
Ohmura-Hoshino M, Goto E, Matsuki Y, Aoki M, Mito M, Uematsu M, Hotta H, Ishido S
Journal of biochemistry  (2006)
PubMed: 16954532
FOXO4 transcriptional activity is regulated by monoubiquitination and USP7/HAUSP.
van der Horst A, de Vries-Smits AM, Brenkman AB, van Triest MH, van den Broek N, Colland F, Maurice MM, Burgering BM
Nature cell biology  (2006)
PubMed: 16964248
The C-terminal tail of the Hedgehog receptor Patched regulates both localization and turnover.
Lu X, Liu S, Kornberg TB
Genes & development  (2006)
PubMed: 16980583
Bone morphogenetic proteins and their antagonists.
Gazzerro E, Canalis E
Reviews in endocrine & metabolic disorders  (2006)
PubMed: 17029022
Numb is a suppressor of Hedgehog signalling and targets Gli1 for Itch-dependent ubiquitination.
Di Marcotullio L, Ferretti E, Greco A, De Smaele E, Po A, Sico MA, Alimandi M, Giannini G, Maroder M, Screpanti I, Gulino A
Nature cell biology  (2006)
PubMed: 17115028
NEDD4-2 (neural precursor cell expressed, developmentally down-regulated 4-2) negatively regulates TGF-beta (transforming growth factor-beta) signalling by inducing ubiquitin-mediated degradation of Smad2 and TGF-beta type I receptor.
Kuratomi G, Komuro A, Goto K, Shinozaki M, Miyazawa K, Miyazono K, Imamura T
The Biochemical journal  (2005)
PubMed: 15496141
CHIP controls the sensitivity of transforming growth factor-beta signaling by modulating the basal level of Smad3 through ubiquitin-mediated degradation.
Xin H, Xu X, Li L, Ning H, Rong Y, Shang Y, Wang Y, Fu XY, Chang Z
The Journal of biological chemistry  (2005)
PubMed: 15781469
Germ-layer specification and control of cell growth by Ectodermin, a Smad4 ubiquitin ligase.
Dupont S, Zacchigna L, Cordenonsi M, Soligo S, Adorno M, Rugge M, Piccolo S
Cell  (2005)
PubMed: 15820681
Showing 1 to 200 of 292 Results
Get Started
Explore
Data
Tools
My GlyGen
Help
About
Glygen
GlyGen is supported and funded by the National Institute of General Medical Sciences under the grant # 1R24GM146616 - 01 and the National Institutes of Health Office of Strategic Coordination - The Common Fund under the grant # 1OT2OD032092.